SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000439542 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439542
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-40
Family Hemopexin-like domain 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439542   Gene: ENSG00000198598   Transcript: ENST00000542648
Sequence length 118
Comment pep:putative chromosome:GRCh38:12:131844961:131850062:1 gene:ENSG00000198598 transcript:ENST00000542648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGG
IDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDG
Download sequence
Identical sequences F5H249
ENSP00000439542 ENSP00000439542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]