SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000439553 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439553
Domain Number 1 Region: 169-466
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.28e-41
Family NadC C-terminal domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  ENSP00000439553
Domain Number - Region: 69-100
Classification Level Classification E-value
Superfamily DUSP-like 0.0209
Family DUSP, domain in ubiquitin-specific proteases 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439553   Gene: ENSG00000229644   Transcript: ENST00000543053
Sequence length 473
Comment pep:known chromosome:GRCh38:10:36522819:36524237:-1 gene:ENSG00000229644 transcript:ENST00000543053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKE
KIQEAKDVYKEHFQDDVVNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTD
PECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGV
SSQETAGIGASAHLVNFKGTDTVAGLALNKKYYGTKDPVPGYSVPAAEHSTITAWGKDHE
KDAFEHIVTQFSSVPVSVVSNSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPL
DTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENI
AFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAG
NFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHH
Download sequence
Identical sequences ENSP00000439553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]