SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000440796 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440796
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.1e-21
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440796   Gene: ENSG00000164338   Transcript: ENST00000543251
Sequence length 328
Comment pep:known chromosome:GRCh38:5:73565741:73583377:1 gene:ENSG00000164338 transcript:ENST00000543251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDARTSESVLSVEHGQPVESVLLFPSGGLLVSAGGRYVKVWDMLKGGQLLVSLKNHHKT
VTCLCLSSSGQRLLSGSLDRKVKVYSTTSYKVVHSFDYAASILSLALAHEDETIVVGMTN
GILSVKHRKSEAKKESLPRRRRPAYRTFIKGKNYMKQRDDILINRPAKKHLELYDRDLKH
FRISKALDRVLDPTCTIKTPEITVSIIKELNRRGVLANALAGRDEKEISHVLNFLIRNLS
QPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLLLQGLVEKEIDYQRELLETLGMMDML
FATMRRKEGTSVLEHTSDGFPENKKIES
Download sequence
Identical sequences ENSP00000440796 NP_001271360.1.87134 NP_001271360.1.92137 ENSP00000440796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]