SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000440941 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000440941
Domain Number - Region: 83-105
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0968
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440941   Gene: ENSG00000118557   Transcript: ENST00000539172
Sequence length 110
Comment pep:known chromosome:GRCh38:16:72154294:72171897:-1 gene:ENSG00000118557 transcript:ENST00000539172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQA
QALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYS
Download sequence
Identical sequences F5GXW3
ENSP00000440941 ENSP00000440941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]