SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000440987 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440987
Domain Number 1 Region: 99-159
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 8.18e-16
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000528
Further Details:      
 
Domain Number 2 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000545
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440987   Gene: ENSG00000123297   Transcript: ENST00000540550
Sequence length 167
Comment pep:known chromosome:GRCh38:12:57782745:57797587:1 gene:ENSG00000123297 transcript:ENST00000540550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKENWEKT
Download sequence
Identical sequences gi|291084498|ref|NP_001166166.1| ENSP00000440987 NP_001166166.1.87134 NP_001166166.1.92137 ENSP00000440987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]