SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000441205 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441205
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 5.5e-41
Family FKBP immunophilin/proline isomerase 0.000000895
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 8.07e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 1.83e-26
Family FKBP immunophilin/proline isomerase 0.000000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441205   Gene: ENSG00000096060   Transcript: ENST00000539068
Sequence length 457
Comment pep:known chromosome:GRCh38:6:35573585:35688915:-1 gene:ENSG00000096060 transcript:ENST00000539068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Download sequence
Identical sequences Q13451
ENSP00000338160 9606.ENSP00000338160 ENSP00000349811 ENSP00000441205 ENSP00000444810 ENSP00000349811 ENSP00000441205 ENSP00000444810 NP_001139247.1.87134 NP_001139247.1.92137 NP_001139248.1.87134 NP_001139248.1.92137 NP_004108.1.87134 NP_004108.1.92137 gi|224809327|ref|NP_001139247.1| gi|224809329|ref|NP_001139248.1| gi|4758384|ref|NP_004108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]