SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442048 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442048
Domain Number 1 Region: 597-767
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 35-237
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 253-322,380-414
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 457-563
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000203
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442048   Gene: ENSG00000159842   Transcript: ENST00000544583
Sequence length 813
Comment pep:known chromosome:GRCh38:17:1003527:1187322:-1 gene:ENSG00000159842 transcript:ENST00000544583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIY
INQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDS
QVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDS
HTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDID
PRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDC
KWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIER
LKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFV
LSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTL
EVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEI
VDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFG
VKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDIL
LMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPD
PNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHD
VMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences A0A2J8JKI6
ENSP00000442048 ENSP00000461565 ENSP00000478880 ENSP00000442048 ENSP00000461565 NP_001153218.1.87134 NP_001153218.1.92137 NP_001309769.1.87134 NP_001309769.1.92137 XP_008968180.1.60992 XP_018868884.1.27298 gi|229094128|ref|NP_001153218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]