SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442365 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442365
Domain Number 1 Region: 198-348,413-479,519-686
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.94e-47
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 648-692,719-795
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000282
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442365   Gene: ENSG00000125746   Transcript: ENST00000536630
Sequence length 796
Comment pep:known chromosome:GRCh38:19:45609402:45643727:-1 gene:ENSG00000125746 transcript:ENST00000536630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDDNLSGTSGMEVDDRVSALEQRLQLQEDELAVLKAALADALRRLRACEEQGAALRAR
GTPKGRAPPRLGTTASVCQLLKGLPTRTPLNGSGPPRRVGGYATSPSSPKKEATSGRSSV
RRYLSPERLASVRREDPRSRTTSSSSNCSAKKEGKTKEVIFSVEDGSVKMFLRGRPVPMM
IPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSV
EEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVL
GLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATF
HPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGG
NLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEV
PEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFV
TCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLV
AIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLD
WAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADG
TDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMA
LTTGGKDTSVLQWRVV
Download sequence
Identical sequences ENSP00000442365 ENSP00000442365 NP_001180198.1.87134 NP_001180198.1.92137 gi|300795605|ref|NP_001180198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]