SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442715 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442715
Domain Number 1 Region: 226-317
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.35e-34
Family ets domain 0.00000724
Further Details:      
 
Domain Number 2 Region: 114-212
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.74e-29
Family Pointed domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442715   Gene: ENSG00000124664   Transcript: ENST00000544425
Sequence length 319
Comment pep:known chromosome:GRCh38:6:34537802:34556333:-1 gene:ENSG00000124664 transcript:ENST00000544425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYL
SYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLE
QVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAG
KELCAMSEEQFRQRSPLGGDVLHAHLDIWKSASTSEESWTDSEVDSSCSGQPIHLWQFLK
ELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKG
IIRKPDISQRLVYQFVHPI
Download sequence
Identical sequences ENSP00000442715 NP_001239223.1.87134 NP_001239223.1.92137 ENSP00000442715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]