SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442841 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442841
Domain Number 1 Region: 234-502
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 4.58e-87
Family ATP-dependent DNA ligase DNA-binding domain 0.000000000114
Further Details:      
 
Domain Number 2 Region: 503-721
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.32e-56
Family ATP-dependent DNA ligase catalytic domain 0.00000000198
Further Details:      
 
Domain Number 3 Region: 723-869
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.97e-48
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0000000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442841   Gene: ENSG00000105486   Transcript: ENST00000427526
Sequence length 888
Comment pep:novel chromosome:GRCh38:19:48115450:48170344:-1 gene:ENSG00000105486 transcript:ENST00000427526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRSIMAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQV
SPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQSEDEDREAKR
KKEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQEL
QEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKN
NYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVL
YLSLNHLGPPQQGLELGVGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQR
LMLPPPPLTASGVFSKFRDIARLTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLR
LGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAEARKTWLEEQGMILKQTFCEVP
DLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEEAAFTCEYKYDG
QRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQ
IQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEG
EFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLD
GVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQS
LKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLR
FPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY
Download sequence
Identical sequences ENSP00000442841 ENSP00000442841 NP_001275992.1.87134 NP_001275992.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]