SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442962 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442962
Domain Number 1 Region: 277-625
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.92e-88
Family YicI catalytic domain-like 0.0000534
Further Details:      
 
Domain Number 2 Region: 627-709
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.17e-22
Family Putative glucosidase YicI, domain 3 0.0066
Further Details:      
 
Domain Number 3 Region: 4-80,145-274
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000471
Family YicI N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442962   Gene: ENSG00000089597   Transcript: ENST00000540933
Sequence length 847
Comment pep:known chromosome:GRCh38:11:62624832:62646726:-1 gene:ENSG00000089597 transcript:ENST00000540933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFR
LDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGK
AEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPY
RLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGK
MMDYLQGSGETPQTDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYH
QSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLA
SKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTM
RAWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGL
YVHMATADGLRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLG
LVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDII
RDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPV
SDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVR
RSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSA
DPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVAS
DWSIHLR
Download sequence
Identical sequences F5H6X6
ENSP00000442962 ENSP00000442962 NP_001265123.1.87134 NP_001265123.1.92137 XP_016872901.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]