SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443058 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443058
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.54e-70
Family Phosphate binding protein-like 0.00000519
Further Details:      
 
Domain Number 2 Region: 201-240,274-295
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.000000000445
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443058   Gene: ENSG00000256269   Transcript: ENST00000542729
Sequence length 304
Comment pep:novel chromosome:GRCh38:11:119084885:119093546:1 gene:ENSG00000256269 transcript:ENST00000542729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLF
TKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETL
PEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMG
WHNRVGQILHPEECMYAVGQEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQA
TIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQL
NDAH
Download sequence
Identical sequences NP_001245138.1.87134 NP_001245138.1.92137 ENSP00000443058 ENSP00000443058 ENSP00000461906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]