SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443283 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443283
Domain Number 1 Region: 272-529
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.27e-76
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 148-255
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 47-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000381
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 87-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443283   Gene: ENSG00000148702   Transcript: ENST00000542051
Sequence length 534
Comment pep:known chromosome:GRCh38:10:113550837:113589602:1 gene:ENSG00000148702 transcript:ENST00000542051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLTHAENPDWYYTEDQADPCQPNPCEHGG
DCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPS
CSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRGKM
NRTVNQHACLYWNSHLLLQENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIKVTNDKV
KWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHP
WQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKTRHLKVVLGDQDLKKEEFH
EQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCALESKYVKTVCLPDGSFPSGSE
CHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDSMICAGNLQKPGQDTCQ
GDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVYTQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences ENSP00000443283 NP_001171131.1.87134 NP_001171131.1.92137 gi|295054188|ref|NP_001171131.1| ENSP00000443283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]