SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443657 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443657
Domain Number 1 Region: 23-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-47
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 258-455
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.06e-46
Family BAR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 751-820
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-18
Family SH3-domain 0.0000147
Further Details:      
 
Domain Number 4 Region: 523-600
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-16
Family SH3-domain 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443657   Gene: ENSG00000107554   Transcript: ENST00000543621
Sequence length 823
Comment pep:known chromosome:GRCh38:10:99875577:99914081:-1 gene:ENSG00000107554 transcript:ENST00000543621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLSSQSSSLVAPSGSVSAENPEQRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPM
QQAQVPNIDFEGLFGNMQMVIKVSKQLLAALEISDAVGPVFLGHRDELEGTYKIYCQNHD
EAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLM
ELLNSTPESHPDKVPLTNAVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNI
HSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRES
ACVKVVAAVSMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMF
TGPHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQY
AQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQV
FTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAER
NFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSD
ASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQDASPPPKECD
QGTLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVKQPTATPRSYRNFRHPEI
VGYSVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSV
SANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences ENSP00000443657 ENSP00000443657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]