SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443727 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443727
Domain Number 1 Region: 2-36
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0000000589
Family Hemopexin-like domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443727   Gene: ENSG00000198598   Transcript: ENST00000537848
Sequence length 39
Comment pep:known chromosome:GRCh38:12:131844870:131851030:1 gene:ENSG00000198598 transcript:ENST00000537848 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGPAVLALR
Download sequence
Identical sequences A0A2J8IZW6 A0A2J8S8P6 F5H846
ENSP00000443727 ENSP00000443727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]