SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444042 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444042
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.38e-50
Family G proteins 0.00000000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444042   Gene: ENSG00000132341   Transcript: ENST00000535090
Sequence length 199
Comment pep:putative chromosome:GRCh38:12:130872076:130875784:1 gene:ENSG00000132341 transcript:ENST00000535090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGEPQLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVW
DTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKV
DIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAP
PEVVMDPALAAQYEHDLEV
Download sequence
Identical sequences A0A2J8MCF6 A0A2J8S8Q6
ENSP00000444042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]