SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444271 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444271
Domain Number 1 Region: 37-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-30
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 2 Region: 206-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-27
Family Spermadhesin, CUB domain 0.0000368
Further Details:      
 
Domain Number 3 Region: 152-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000447
Family EGF-type module 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSP00000444271
Domain Number - Region: 321-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00516
Family Complement control module/SCR domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444271   Gene: ENSG00000159403   Transcript: ENST00000536053
Sequence length 360
Comment pep:putative chromosome:GRCh38:12:7088610:7091892:-1 gene:ENSG00000159403 transcript:ENST00000536053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRFRVGREENAQWWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTT
VITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFM
SQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCH
NYVGGYFCSCRPGYELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRV
ERGLTLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLL
FFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIE
Download sequence
Identical sequences ENSP00000444271 ENSP00000444271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]