SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000444979 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444979
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily DNA clamp 4.19e-16
Family DNA polymerase processivity factor 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444979   Gene: ENSG00000172613   Transcript: ENST00000544620
Sequence length 247
Comment pep:putative chromosome:GRCh38:11:67391958:67396312:1 gene:ENSG00000172613 transcript:ENST00000544620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQA
VFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMV
TEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDS
LLDGHFV
Download sequence
Identical sequences A0A2J8QB23 F5H4F1
ENSP00000444979 ENSP00000444979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]