SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445088 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445088
Domain Number 1 Region: 4-324
Classification Level Classification E-value
Superfamily ALDH-like 1.26e-62
Family ALDH-like 0.0000364
Further Details:      
 
Domain Number 2 Region: 344-605
Classification Level Classification E-value
Superfamily ALDH-like 4.84e-44
Family ALDH-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445088   Gene: ENSG00000161618   Transcript: ENST00000540132
Sequence length 639
Comment pep:putative chromosome:GRCh38:19:49453225:49470534:1 gene:ENSG00000161618 transcript:ENST00000540132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGVIGLILPPTFSFLEMMWRICPALAVGCTVVALVPPASPAPLLLAQLAGELGPFPGI
LNVLSGPASLVPILASQPGIRKVAFCGAPEEGRALRRSLAGECAELGLALGTESLLLLTD
TADVDSAVEGVVDAAWSDRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMG
ARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVEVPWPV
VVASPFRTAKEALLVANGTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPSVP
TGGCKESGCSWHGGPDGLYEYLRPSGTPARLSCLSKNLNYDTFGLAVPSTLPAGPEIGPS
PAPPYGLFVGGRFQAPGARSSRPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQ
SPGARAALLWALAAALERRKSTLASRLERQGAELKAAEAEVELSARRLRAWGARVQAQGH
TLQVAGLRGPVLRLREPLGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVMVPSAACPLLA
LEVCQDMATVFPAGLANVVTGDRDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLK
PVWASRGCPRAWDQEAEGAGPELGLRVARTKALWLPMGD
Download sequence
Identical sequences F5H4B6
ENSP00000445088 ENSP00000445088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]