SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445552 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445552
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 8.16e-33
Family PaaI/YdiI-like 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445552   Gene: ENSG00000112304   Transcript: ENST00000537591
Sequence length 117
Comment pep:known chromosome:GRCh38:6:24667035:24705065:1 gene:ENSG00000112304 transcript:ENST00000537591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAPGVS
VDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
Download sequence
Identical sequences gi|231567183|ref|NP_001153566.1| ENSP00000445552 ENSP00000445552 NP_001153566.1.87134 NP_001153566.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]