SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445599 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445599
Domain Number 1 Region: 19-191
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.82e-53
Family Phosphate binding protein-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445599   Gene: ENSG00000256269   Transcript: ENST00000546302
Sequence length 191
Comment pep:novel chromosome:GRCh38:11:119084900:119092164:1 gene:ENSG00000256269 transcript:ENST00000546302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALEKNERENPHDAVVFHPKFVGKTLETLPEKSVVGTS
SLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQIL
HPEECMYAVGQ
Download sequence
Identical sequences F5H226
ENSP00000445599 ENSP00000459435 ENSP00000445599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]