SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445620 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445620
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.57e-16
Family Hemopexin-like domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445620   Gene: ENSG00000198598   Transcript: ENST00000535004
Sequence length 143
Comment pep:putative chromosome:GRCh38:12:131845295:131851367:1 gene:ENSG00000198598 transcript:ENST00000535004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDW
LVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAA
TMLLLLPPLSPGALWTAAQALTL
Download sequence
Identical sequences F5H209
ENSP00000445620 ENSP00000445620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]