SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445949 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445949
Domain Number 1 Region: 649-859
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-40
Family DBL homology domain (DH-domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 849-966
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-23
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 998-1062
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 1018-1176
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-16
Family Pleckstrin-homology domain (PH domain) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445949   Gene: ENSG00000154783   Transcript: ENST00000543601
Sequence length 1178
Comment pep:known chromosome:GRCh38:3:14818962:14934565:1 gene:ENSG00000154783 transcript:ENST00000543601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDAEDTSEEPPEKEELAGVQEAETATDCPEVLEEGCEEATGVTGGEQVDLSEPPDHEK
KTNQEVAAATLEDHAQDESAEESCQIVPFENDCMEDFVTSLTGSPYEFFPTESTSFCSES
CSPLSESAKGLESEQAPKLGLRAEENPMVGALCGQCGSLQGGAAEGPAAPDVVVVLEEEA
LDDALANPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEELNCEAEGGLVPADRKNTSTR
VRPHSGKVAGYVPETVPEETGPEAGSSAPGIGGAAEEVGKTLLSLEGKPLEASRALPAKP
RAFTLYPRSFSVEGREIPVSVYQEPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNHL
PSSGTSTPSSMVDIPPPFDLACITKKPITKSSPSLLIESDSPDKYKKKKSSFKRFLALTF
KKKTENKLHVDVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPSS
LIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMN
SDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDAE
SAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKVEGQSRALVIAQELL
SSEKAYVEMLQHLNLDFHGAVMRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGILE
ELEERLSNWESQQKVADVFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVREF
EQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDRA
NDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVLL
YTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGC
LSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRR
HHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSFP
LSSPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEDKVALESMPLLGFTIAPEKEEGSSE
VGPIFHLYHKKTLFYSFKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences B7ZM68
ENSP00000445949 ENSP00000445949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]