SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000446075 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446075
Domain Number 1 Region: 104-155
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000085
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446075   Gene: ENSG00000139722   Transcript: ENST00000535765
Sequence length 271
Comment pep:novel chromosome:GRCh38:12:122867154:122896127:-1 gene:ENSG00000139722 transcript:ENST00000535765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEENVQLNKEMTLASNRSLAEGNLLY
QPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTE
NMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPE
LAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPP
LPPRVGLPTQQGFSSQFVSPYPPPLPQRPPP
Download sequence
Identical sequences F5H4M0
ENSP00000446075 ENSP00000446075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]