SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446298 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446298
Domain Number 1 Region: 27-94
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000526
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446298   Gene: ENSG00000107186   Transcript: ENST00000535169
Sequence length 95
Comment pep:known chromosome:GRCh38:9:13125216:13140070:-1 gene:ENSG00000107186 transcript:ENST00000535169 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAG
NKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEK
Download sequence
Identical sequences H0YH70
ENSP00000446298 ENSP00000446298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]