SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446555 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000446555
Domain Number - Region: 215-282
Classification Level Classification E-value
Superfamily Tropomyosin 0.000589
Family Tropomyosin 0.0081
Further Details:      
 
Domain Number - Region: 95-193
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446555   Gene: ENSG00000139220   Transcript: ENST00000548790
Sequence length 284
Comment pep:novel chromosome:GRCh38:12:81369125:81445578:-1 gene:ENSG00000139220 transcript:ENST00000548790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHKALDEKVRERLRVSLERVSALEEELAAANQEIVALREQNVHIQRKMASSEGSTESEHL
EGMEPGQKVHEKRLSNGSIDSTDETSQIVELQELLEKQNYEMAQMKERLAALSSRVGEVE
QEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMND
KLENELANKEAILRQVQYLCLGFLLVCAFSSFSQNGMEEKNRQLQERLELAEQKLQQTMR
KAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEGQLEEKN
Download sequence
Identical sequences H0YH95
ENSP00000446555 ENSP00000446555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]