SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446634 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446634
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 3.71e-18
Family Ribosomal proteins L15p and L18e 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446634   Gene: ENSG00000063177   Transcript: ENST00000546623
Sequence length 167
Comment pep:novel chromosome:GRCh38:19:48615333:48617797:-1 gene:ENSG00000063177 transcript:ENST00000546623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTIT
DDVRVQEVPKLKPCPLHQVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSG
PRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN
Download sequence
Identical sequences H0YHA7
ENSP00000446634 ENSP00000446634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]