SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000446979 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446979
Domain Number 1 Region: 259-449
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.84e-59
Family Hemopexin-like domain 0.00011
Further Details:      
 
Domain Number 2 Region: 100-234
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.35e-38
Family Matrix metalloproteases, catalytic domain 0.0000988
Further Details:      
 
Domain Number 3 Region: 29-89
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000173
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446979   Gene: ENSG00000123342   Transcript: ENST00000548629
Sequence length 485
Comment pep:novel chromosome:GRCh38:12:55836801:55842950:-1 gene:ENSG00000123342 transcript:ENST00000548629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLARAALRQAFQDWSNVAPLT
FQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRG
VNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIR
DEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPL
FRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAA
LYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFF
KGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATE
TTFEY
Download sequence
Identical sequences F8W1C3
ENSP00000446979 ENSP00000446979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]