SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447213 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447213
Domain Number 1 Region: 56-108
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000467
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447213   Gene: ENSG00000151322   Transcript: ENST00000551008
Sequence length 155
Comment pep:novel chromosome:GRCh38:14:33215213:33681042:1 gene:ENSG00000151322 transcript:ENST00000551008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDFANQGDPPWNLRMEGPPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFV
FALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLS
QGTAEDGASSASSSSQSETPEPVVCFPPASDQFLL
Download sequence
Identical sequences A0A2I2Y836 A0A2I3S7D7 A0A2K5JUV6 A0A2K5VFW8 A0A2K6R019 F8W0C2
ENSP00000447213 ENSP00000447213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]