SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447234 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447234
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.52e-30
Family Nitrogenase iron protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447234   Gene: ENSG00000151413   Transcript: ENST00000551314
Sequence length 133
Comment pep:putative chromosome:GRCh38:14:31561624:31787822:1 gene:ENSG00000151413 transcript:ENST00000551314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPS
VPKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRGLMVMSAIEKLLRQV
DWGQLDYLVVDMP
Download sequence
Identical sequences F8W061
ENSP00000447234 ENSP00000447234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]