SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447365 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000447365
Domain Number - Region: 15-44
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00948
Family Methyl-CpG-binding domain, MBD 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447365   Gene: ENSG00000166987   Transcript: ENST00000552255
Sequence length 45
Comment pep:known chromosome:GRCh38:12:57523063:57524742:1 gene:ENSG00000166987 transcript:ENST00000552255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELS
Download sequence
Identical sequences A0A2J8UH09 F8VZD7
ENSP00000447365 ENSP00000447365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]