SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447464 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447464
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily ALDH-like 7.85e-25
Family ALDH-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447464   Gene: ENSG00000136010   Transcript: ENST00000548418
Sequence length 92
Comment pep:putative chromosome:GRCh38:12:105030070:105031935:-1 gene:ENSG00000136010 transcript:ENST00000548418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLVYGGRQVQRPGFFM
EPTVFTDVEDYMYLAKEESFGPIMVISKFQNG
Download sequence
Identical sequences H0YHN9
ENSP00000447464 ENSP00000447464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]