SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447707 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447707
Domain Number 1 Region: 29-108
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000253
Family Extracellular domain of cell surface receptors 0.021
Further Details:      
 
Weak hits

Sequence:  ENSP00000447707
Domain Number - Region: 100-154
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0212
Family NadC C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447707   Gene: ENSG00000106799   Transcript: ENST00000546584
Sequence length 188
Comment pep:putative chromosome:GRCh38:9:99127934:99132739:1 gene:ENSG00000106799 transcript:ENST00000546584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTGIWPQGVYSFIGERKTKLAILNLSLFPALQCFCHLCTKDNFTCVTDGLCFVSVTETTD
KVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGP
VELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYD
MTTSGSGS
Download sequence
Identical sequences ENSP00000447707 ENSP00000447707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]