SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447911 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447911
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-29
Family FKBP immunophilin/proline isomerase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447911   Gene: ENSG00000134285   Transcript: ENST00000552878
Sequence length 182
Comment pep:putative chromosome:GRCh38:12:48922565:48925511:-1 gene:ENSG00000134285 transcript:ENST00000552878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYG
KRGFPPSVPDGVSLLLPRLECNSAIFTHHNLRHPGSSNSPVSASRVAGITGMRHHDRLIL
YF
Download sequence
Identical sequences F8VU90
ENSP00000447911 ENSP00000447911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]