SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448070 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448070
Domain Number 1 Region: 16-81
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000163
Family Methyl-CpG-binding domain, MBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448070   Gene: ENSG00000166987   Transcript: ENST00000548887
Sequence length 148
Comment pep:known chromosome:GRCh38:12:57520710:57525414:1 gene:ENSG00000166987 transcript:ENST00000548887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELSSLEQTRSYLLSDGTC
KCGLECPLNVPKVFNFDPLAPVTPGGAGVGPASEEDMTKLCNHRRKAVAMATLYRSMETT
CSHSSPGEGASPQMFHTVSPGPPSARPP
Download sequence
Identical sequences A0A2J8KW46 A0A2J8UH37 F8VU14
ENSP00000448070 ENSP00000448070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]