SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448110 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000448110
Domain Number - Region: 63-126
Classification Level Classification E-value
Superfamily Ribosomal protein L20 0.0767
Family Ribosomal protein L20 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448110   Gene: ENSG00000050426   Transcript: ENST00000550442
Sequence length 144
Comment pep:novel chromosome:GRCh38:12:51048320:51056391:1 gene:ENSG00000050426 transcript:ENST00000550442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYV
VTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQL
PYREMEHLRQKALSRAMLLTSYLP
Download sequence
Identical sequences A0A2J8KDU8 F8VTR1
ENSP00000448110 ENSP00000448110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]