SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448161 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448161
Domain Number 1 Region: 608-870
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.04e-67
Family WD40-repeat 0.0000737
Further Details:      
 
Domain Number 2 Region: 801-871,906-1127
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.8e-51
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 3 Region: 107-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.09e-45
Family Extended AAA-ATPase domain 0.032
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-24
Family Caspase recruitment domain, CARD 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448161   Gene: ENSG00000120868   Transcript: ENST00000549007
Sequence length 1163
Comment pep:known chromosome:GRCh38:12:98648360:98732566:1 gene:ENSG00000120868 transcript:ENST00000549007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLWNTDSRSKVADCRGHLS
WVHGVMFSPDGSSFLTSSDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHI
RRLQLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHK
KTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSF
DGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWNVSNGELLHLC
APLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHV
SPDFKTYVTVDNLGILYILQTLE
Download sequence
Identical sequences C9JLV4
ENSP00000448161 ENSP00000341830 ENSP00000448161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]