SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448407 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448407
Domain Number 1 Region: 184-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 17-76
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000492
Family VWC domain 0.026
Further Details:      
 
Domain Number 3 Region: 143-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000342
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 74-142
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000847
Family VWC domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448407   Gene: ENSG00000184613   Transcript: ENST00000550313
Sequence length 246
Comment pep:novel chromosome:GRCh38:12:44610910:44777049:-1 gene:ENSG00000184613 transcript:ENST00000550313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNP
DCPLKSALAYVDGKCSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPA
LDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALREDNA
YCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQHNCDEN
ALCFNT
Download sequence
Identical sequences ENSP00000448407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]