SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448450 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448450
Domain Number 1 Region: 79-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000925
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448450   Gene: ENSG00000151322   Transcript: ENST00000552874
Sequence length 132
Comment pep:putative chromosome:GRCh38:14:33735241:33780871:1 gene:ENSG00000151322 transcript:ENST00000552874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVV
VAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAE
DVEGIRHSHLDS
Download sequence
Identical sequences H0YI42
ENSP00000448450 ENSP00000448450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]