SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448980 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448980
Domain Number 1 Region: 87-178
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-21
Family Canonical RBD 0.000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448980   Gene: ENSG00000063046   Transcript: ENST00000550390
Sequence length 185
Comment pep:known chromosome:GRCh38:12:53006484:53027872:1 gene:ENSG00000063046 transcript:ENST00000550390 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKGTP
GPYRI
Download sequence
Identical sequences A0A2J8KDC5 F8VYE9
ENSP00000448980 ENSP00000448980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]