SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450017 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450017
Domain Number 1 Region: 2-28
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000513
Family Homeodomain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450017   Gene: ENSG00000152804   Transcript: ENST00000472590
Sequence length 98
Comment pep:putative chromosome:GRCh38:10:92691820:92695641:1 gene:ENSG00000152804 transcript:ENST00000472590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLD
SSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG
Download sequence
Identical sequences A0A2J8PE74 F8VU08
ENSP00000447953 ENSP00000450017 ENSP00000447953 ENSP00000450017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]