SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450040 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450040
Domain Number 1 Region: 8-364
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 9.29e-97
Family Glutaminase/Asparaginase 0.000000091
Further Details:      
 
Domain Number 2 Region: 402-559
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.39e-32
Family Ankyrin repeat 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450040   Gene: ENSG00000166183   Transcript: ENST00000551177
Sequence length 573
Comment pep:known chromosome:GRCh38:14:104085679:104115581:1 gene:ENSG00000166183 transcript:ENST00000551177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAVGPERRLLAVYTGGTIGMRSELGVLVPGTGLAAILRTLPMFHDEEHARARGLSEDT
LVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTDTMA
FAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRATKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDGKAGLVVHSSMEQDVGL
LRLYPGIPAALVRAFLQPPLKGVVMETFGSGNGPTKPDLLQELRVATERGLVIVNCTHCL
QGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDVRKELLTKDLRGEM
TPPSVEERRPSLQGNTLGGGVSWLLSLSGSQEADALRNALVPSLACAAAHAGDVEALQAL
VELGSDLGLVDFNGQTPLHAAARGGHTEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGRHP
GVIGLLREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHV
AEAAGNLAVVAFLQSLEGAVGAQAPCPEVLPGV
Download sequence
Identical sequences Q86U10
ENSP00000450040 gi|320461543|ref|NP_001073933.2| NP_001073933.2.87134 NP_001073933.2.92137 ENSP00000450040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]