SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450041 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450041
Domain Number 1 Region: 99-189
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.78e-18
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000058
Further Details:      
 
Domain Number 2 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000817
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450041   Gene: ENSG00000123297   Transcript: ENST00000548851
Sequence length 200
Comment pep:putative chromosome:GRCh38:12:57782787:57808071:1 gene:ENSG00000123297 transcript:ENST00000548851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIVLRTHHICMI
Download sequence
Identical sequences F8VPA7
ENSP00000450041 ENSP00000450041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]