SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450240 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450240
Domain Number 1 Region: 62-183
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-27
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 213-278
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.01e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 21-75
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000837
Family DBL homology domain (DH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450240   Gene: ENSG00000180263   Transcript: ENST00000551521
Sequence length 279
Comment pep:putative chromosome:GRCh38:12:95091707:95116973:-1 gene:ENSG00000180263 transcript:ENST00000551521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLRPQVILNCLRRSRPCSLCQDYLKNLIEDAGDYRDTQDALAVVIEVANHANDTMKQG
DNFQKLMQIQYSLNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQS
GMYKLNNMLSLAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEE
YAKKRITFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHC
RACGKIVCQACSSNKYGLDYLKNQPARVCEHCFQELQKL
Download sequence
Identical sequences A0A2J8KVM1 F8VQX5
ENSP00000450240 ENSP00000450240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]