SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450353 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450353
Domain Number 1 Region: 28-261
Classification Level Classification E-value
Superfamily ALDH-like 5.76e-84
Family ALDH-like 0.000000000831
Further Details:      
 
Weak hits

Sequence:  ENSP00000450353
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 0.00552
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450353   Gene: ENSG00000257767   Transcript: ENST00000546840
Sequence length 261
Comment pep:putative chromosome:GRCh38:12:111753890:111791418:1 gene:ENSG00000257767 transcript:ENST00000546840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLMDLAGNKAAALDIAMIKMVAPSMASRVIDRAIQIFINNEWHDAVSRKTFPTVNPSTGE
VICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALE
TLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQII
PWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
TAGAAIASHEDVDKVAFTGST
Download sequence
Identical sequences ENSP00000450353 ENSP00000450353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]