SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450370 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450370
Domain Number 1 Region: 15-53
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000981
Family Methyl-CpG-binding domain, MBD 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450370   Gene: ENSG00000166987   Transcript: ENST00000551351
Sequence length 53
Comment pep:known chromosome:GRCh38:12:57520965:57524765:1 gene:ENSG00000166987 transcript:ENST00000551351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELSSLEQTRSY
Download sequence
Identical sequences A0A2J8KW47 A0A2J8UH72 F8VNX1
ENSP00000448202 ENSP00000450370 ENSP00000448202 ENSP00000450370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]