SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450709 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450709
Domain Number 1 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-21
Family Fibronectin type II module 0.00085
Further Details:      
 
Domain Number 2 Region: 183-293
Classification Level Classification E-value
Superfamily HCP-like 6.54e-17
Family HCP-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450709   Gene: ENSG00000071537   Transcript: ENST00000555824
Sequence length 301
Comment pep:known chromosome:GRCh38:14:81498808:81533833:-1 gene:ENSG00000071537 transcript:ENST00000555824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLVSR
L
Download sequence
Identical sequences NP_001231913.1.87134 NP_001231913.1.92137 ENSP00000450709 ENSP00000450709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]