SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450732 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450732
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.44e-17
Family Transcription factor STAT-4 N-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450732   Gene: ENSG00000166888   Transcript: ENST00000553275
Sequence length 64
Comment pep:known chromosome:GRCh38:12:57107666:57111413:-1 gene:ENSG00000166888 transcript:ENST00000553275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHL
Download sequence
Identical sequences A0A2J8KWE5 G3V2L2
ENSP00000450732 ENSP00000450732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]