SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450849 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450849
Domain Number 1 Region: 19-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-17
Family Canonical RBD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450849   Gene: ENSG00000119705   Transcript: ENST00000557431
Sequence length 124
Comment pep:putative chromosome:GRCh38:14:77708103:77761104:1 gene:ENSG00000119705 transcript:ENST00000557431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHR
GLGWVQFSSEEGLRNALQQENHIIDGVKESLFRDTQWTAKGERPPQANGRKAAQSQPARF
TPPK
Download sequence
Identical sequences A0A2I2YWF4 A0A2I3TDC9 G3V2S9
ENSP00000450849 ENSP00000450849 ENSP00000450587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]