SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000451144 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451144
Domain Number 1 Region: 114-149
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000251
Family Fibronectin type II module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451144   Gene: ENSG00000071537   Transcript: ENST00000557372
Sequence length 163
Comment pep:novel chromosome:GRCh38:14:81504263:81533849:-1 gene:ENSG00000071537 transcript:ENST00000557372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPDKEYDEC
TSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQMQEAE
Download sequence
Identical sequences A0A2J8PKK0 G3V3B3
ENSP00000451144 ENSP00000451144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]